GenBank Format

LOCUS       AL3CSA        105 bp ss-DNA             PHG       15-JUN-1988
DEFINITION  Bacteriophage alpha-3 cleavage site for phage phi-X174 gene A
            protein.
ACCESSION   M10631
NID         g166099
KEYWORDS    cleavage site; gene A protein.
SOURCE      Bacteriophage alpha-3 DNA.
  ORGANISM  Bacteriophage alpha3
            Viridae; ds-DNA nonenveloped viruses; Siphoviridae.
REFERENCE   1  (bases 1 to 105)
  AUTHORS   Heidekamp,F., Baas,P.D. and Jansz,H.S.
  TITLE     Nucleotide sequences at the phi-X gene A protein cleavage site in
            replicative form I DNAs of bacteriophages U3, G14, and Alpha-3
  JOURNAL   J. Virol. 42, 91-99 (1982)
  MEDLINE   82217015
FEATURES             Location/Qualifiers
     source          1..105
                     /organism="Bacteriophage alpha3"
     CDS             <1..>105
                     /note="unspecified peptide"
                     /codon_start=1
                     /transl_table=11
                     /db_xref="PID:g166100"
                     /translation="ESQTALLEDHMALVRKCAAQLDNSNTIDHRTPLDA"
BASE COUNT       26 a     29 c     24 g     26 t
ORIGIN      
        1 gagtctcaga ctgcccttct ggaagaccat atggcactgg ttcggaagtg tgctgcccaa
       61 cttgataata gtaacactat agaccaccgt acccctttgg atgcc